PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G1297
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 369aa    MW: 40843.3 Da    PI: 6.7902
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G1297genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++v+ +G g+W+++++  g+ R++k+c++rw +yl
      Gh_D05G1297 17 RGLWSPEEDEKLINYVTTYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 64
                     788*******************************************97 PP

2Myb_DNA-binding48.32.2e-1570112145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+++++E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
      Gh_D05G1297  70 RGSFSPQEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 112
                      899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-27967IPR009057Homeodomain-like
PROSITE profilePS5129425.1021268IPR017930Myb domain
SuperFamilySSF466899.73E-3014111IPR009057Homeodomain-like
SMARTSM007171.1E-131666IPR001005SANT/Myb domain
PfamPF002493.0E-161764IPR001005SANT/Myb domain
CDDcd001673.25E-122064No hitNo description
Gene3DG3DSA:1.10.10.608.3E-2568119IPR009057Homeodomain-like
PROSITE profilePS5129419.26369119IPR017930Myb domain
SMARTSM007171.5E-1569117IPR001005SANT/Myb domain
PfamPF002493.5E-1470113IPR001005SANT/Myb domain
CDDcd001672.95E-1172112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MMGHGHHSCC NKQKVKRGLW SPEEDEKLIN YVTTYGHGCW SSVPKLAGLQ RCGKSCRLRW  60
INYLRPDLKR GSFSPQEAAL IIELHSILGN RWAQIAKHLP GRTDNEVKNF WNSSIKKKFI  120
SHEVPALASF ADVHNFKPPD EAVDFVSLNV NPSLILSDQR DQLYLSPPLL QSFAQHHADF  180
KSNPSGDNVD LIHHHFPLTP MLPPPLSSAS SLDPSWPLPF ITSQHDLDHH QDKKHHVPVF  240
SNEVVHDIFN EKLMNSTAAV NLYDHPLMAA QTVPKLCEIL EGNLCNVPLT SVSLENIDPL  300
GSRLSTCLPI SAGSSYAHDM VVATNQMEFI DTIITSMPSA SSSSSSSLSA LSSGQYITNP  360
NLPSGGWDP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31171187107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.11550.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5780011e-103JX578001.1 Gossypium hirsutum clone NBRI_GE9934 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447965.10.0PREDICTED: transcription factor MYB24
TrEMBLA0A0D2TPY10.0A0A0D2TPY1_G
STRINGPOPTR_0001s20370.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.22e-80myb domain protein 26